PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486389.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 316aa    MW: 34422.2 Da    PI: 7.2909
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486389.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-334296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  XP_004486389.1 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5693999IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-323997IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-244297IPR006447Myb domain, plants
SuperFamilySSF466891.29E-164298IPR009057Homeodomain-like
PfamPF002492.1E-74495IPR001005SANT/Myb domain
PfamPF143792.2E-15140185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MYPRLIHPHE GIVGQEDLQG GVGVGVSNHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDIGEGCKD GMTGSYLLES  120
PGTDNTSPKL PTSDTNEGYE IKEALRAQME VQSKLHLQVE AEKHLQIRQD AERRYMAMLE  180
RACKMLADQF IGATVIDTDN QKFQGIGNKA PRGSLVDHLG FYSLPSTEVA GVNAPEEEIP  240
PCLPSQRADC STESCLTSHE SSGGLTLEGS PGVGKRRMLG MDSMAAPLIW SEAKMKTQAI  300
NLAQGNNPLG ITRYGM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1397930.0BT139793.1 Medicago truncatula clone JCVI-FLMt-13F21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486389.10.0PREDICTED: uncharacterized protein LOC101503318 isoform X1
RefseqXP_004486390.10.0PREDICTED: uncharacterized protein LOC101503318 isoform X1
SwissprotQ9SAK52e-46APL_ARATH; Myb family transcription factor APL
TrEMBLA2Q5E60.0A2Q5E6_MEDTR; Homeodomain-related
STRINGGLYMA09G02030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-63G2-like family protein